General Information

  • ID:  hor001238
  • Uniprot ID:  G5EG31
  • Protein name:  FLP-4
  • Gene name:  flp-4
  • Organism:  Caenorhabditis elegans
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ASPSFIRF
  • Length:  8
  • Propeptide:  MNAFSSSLKTFIFSLLFATLLALTAAHPPSSGEEIAEQEEKNIASPDELIPEIVEQQNFWPPVHLRGLRSSNGKPTFIRFGKRASPSFIRFGK
  • Signal peptide:  MNAFSSSLKTFIFSLLFATLLALTAA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-G5EG31-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001238_AF2.pdbhor001238_ESM.pdb

Physical Information

Mass: 104909 Formula: C44H65N11O11
Absent amino acids: CDEGHKLMNQTVWY Common amino acids: FS
pI: 10.55 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 4
Hydrophobicity: 52.5 Boman Index: -903
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 61.25
Instability Index: 8775 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  20013198
  • Title:  Approaches to Identify Endogenous Peptides in the Soil Nematode Caenorhabditis elegans